OuterStats is here to display any thing is needed for www.websiteribbon.com. We seek and locate Websiteribbon.com information for inquirer. We will show you Websiteribbon value, date of creation, location, hosted server, local language and estimated data - The estimated data is a special algorithm built by us to demonstrate www.websiteribbon.com worth.

Diagonal Advertising Banner Design | Free Corner Web Banner Ads

Free advertising banner web design tool to make on websites a corner diagonal banner ad containing a message and optional link.

Websiteribbon.com was created on the 2007-06-09, domain is hosted in ip: 50.116.4.130, and owner of this ips: LINODE-US . Our algorithm estimates Websiteribbon.com worth to be about $193 and estimates that it gets about 48 visits per day. Websiteribbon.com is located in United States. Websiteribbon.com using Apache/2.2.15 (CentOS) server and powered by unknown.

Created: 09/06/2007

Expires: 15/11/2017

Hosted in: United States

Host IP: 50.116.4.130

ICANN Registrar: ENOM, INC.

Domain Archive: websiteribbon.com in the past

Alexa Rank: #21035622

Google Page Rank: 0

Server DNS A: 50.116.4.130

Server DNS NS: dns1.registrar-servers.com dns5.registrar-servers.com dns3.registrar-servers.com dns4.registrar-servers.com dns2.registrar-servers.com

Server Name: unavailable

Server Type: Apache/2.2.15 (CentOS)

Server Side Language: unavailable

websiteribbon.com - Daily Traffic Rank Trend In The Past 4 Months

Keyword Count Density
Banner 19 8.88
Diagonal 8 3.74
Design 8 3.74
Corner 7 3.27
Advertising 7 3.27
Message 4 1.87
Tahoma 3 1.4
Verdana 3 1.4
Optional 3 1.4
Color 2 0.93
Font 2 0.93
Containing 2 0.93
Webmaster 2 0.93
Scripts 2 0.93
Aliceblueantiquewhiteaquaaquamarineazurebeigebisqueblackblanchedalmondbluebluevioletbrownburlywoodcadetbluechartreusechocolatecoralcornflowerbluecornsilkcrimsoncyandarkbluedarkcyandarkgoldenroddarkgraydarkgreendarkkhakidarkmagentadarkolivegreendarkorangedarkorchiddarkreddarksalmondarkseagreendarkslatebluedarkslategraydarkturquoisedarkvioletdeeppinkdeepskybluedimgraydodgerbluefeldsparfirebrickfloralwhiteforestgreenfuchsiagainsboroghostwhitegoldgoldenrodgraygreengreenyellowhoneydewhotpinkindianredindigoivorykhakilavenderlavenderblushlawngreenlemonchiffonlightbluelightcorallightcyanlightgoldenrodyellowlightgreenlightgreylightpinklightsalmonlightseagreenlightskybluelightslatebluelightslategraylightsteelbluelightyellowlimelimegreenlinenmagentamaroonmediumaquamarinemediumbluemediumorchidmediumpurplemediumseagreenmediumslatebluemediumspringgreenmediumturquoisemediumvioletredmidnightbluemintcreammistyrosemoccasinnavajowhitenavyoldlaceoliveolivedraborangeorangeredorchidpalegoldenrodpalegreenpaleturquoisepalevioletredpapayawhippeachpuffperupinkplumpowderbluepurpleredrosybrownroyalbluesaddlebrownsalmonsandybrownseagreenseashellsiennasilverskyblueslateblueslategraysnowspringgreensteelbluetantealthistletomatoturquoisevioletvioletredwheatwhitewhitesmokeyellowyellowgreen 1 0.47
Submitting 1 0.47
Including 1 0.47
Theme 1 0.47
Choice 1 0.47
Bidding 1 0.47
Resources 1 0.47
Header Key Header Value
Date Mon, 29 May 2017 07:37:59 GMT
Server Apache/2.2.15 (CentOS)
Location http://www.websiteribbon.com/
Content-Length 320
Content-Type text/html; charset=iso-8859-1

We believe that every website pwner is able to earn money from his website.

Our estimations point that your Website Worth is $192.97, Your Daily Visitors could be in the area of 48 per day and your estimated Daily Revenues could be around $0.14.

Server Country Code: US

Server Country Name: United States

Server City Name: Fremont

Server Region Name: CA

Server Zip Code: 94536

Server Latitude: 37.548301696777

Server Longitude: -121.98860168457

Server location

jebsiteribbon.com, zebsiteribbon.com, wbbsiteribbon.com, wfbsiteribbon.com, wjbsiteribbon.com, wwbsiteribbon.com, webaiteribbon.com, webhiteribbon.com, webiiteribbon.com, weboiteribbon.com, webtiteribbon.com, websnteribbon.com, websigeribbon.com, websiieribbon.com, websitewibbon.com, websiterimbon.com, websiterisbon.com, websiteribbtn.com, websiteribbok.com, websiteribboq.com, websiteribbonrcom, websiteribbon.cpm, websiteribbon.com, websiteribbo.ncom, awebsiteribbon.com, twebsiteribbon.com, whebsiteribbon.com, wjebsiteribbon.com, wqebsiteribbon.com, wegbsiteribbon.com, wehbsiteribbon.com, websxiteribbon.com, websitkeribbon.com, websitoeribbon.com, websitweribbon.com, websitzeribbon.com, websitekribbon.com, websitenribbon.com, websiteuribbon.com, websiterhibbon.com, websiterinbbon.com, websiteribjbon.com, websiteribrbon.com, websiteribbosn.com, websiteribbond.com, websiteribbon.jcom, websiteribbon.cjom, websiteribbon.coms, websiteribbon.comx, websiteribbon.comz



Domain Name: WEBSITERIBBON.COM
Registry Domain ID: 1018778613_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.enom.com
Registrar URL: www.enom.com
Updated Date: 2010-10-11T21:32:33.00Z
Creation Date: 2007-06-09T17:06:00.00Z
Registrar Registration Expiration Date: 2017-11-15T04:59:00.00Z
Registrar: ENOM, INC.
Registrar IANA ID: 48
Reseller: NAMECHEAP.COM
Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: WHOISGUARD PROTECTED
Registrant Organization: WHOISGUARD, INC.
Registrant Street: P.O. BOX 0823-03411
Registrant City: PANAMA
Registrant State/Province: PANAMA
Registrant Postal Code:
Registrant Country: PA
Registrant Phone: +507.8365503
Registrant Phone Ext:
Registrant Fax: +51.17057182
Registrant Fax Ext:
Registrant Email: BF0E923F49444019A15AAB7579C1EFC7.******
Registry Admin ID:
Admin Name: WHOISGUARD PROTECTED
Admin Organization: WHOISGUARD, INC.
Admin Street: P.O. BOX 0823-03411
Admin City: PANAMA
Admin State/Province: PANAMA
Admin Postal Code:
Admin Country: PA
Admin Phone: +507.8365503
Admin Phone Ext:
Admin Fax: +51.17057182
Admin Fax Ext:
Admin Email: BF0E923F49444019A15AAB7579C1EFC7.******
Registry Tech ID:
Tech Name: WHOISGUARD PROTECTED
Tech Organization: WHOISGUARD, INC.
Tech Street: P.O. BOX 0823-03411
Tech City: PANAMA
Tech State/Province: PANAMA
Tech Postal Code:
Tech Country: PA
Tech Phone: +507.8365503
Tech Phone Ext:
Tech Fax: +51.17057182
Tech Fax Ext:
Tech Email: BF0E923F49444019A15AAB7579C1EFC7.******
Name Server: DNS1.REGISTRAR-SERVERS.COM
Name Server: DNS2.REGISTRAR-SERVERS.COM
DNSSEC: unSigned
Registrar Abuse Contact Email: ******
Registrar Abuse Contact Phone: +1.4252982646
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2010-10-11T21:32:33.00Z <<<

For more information on Whois status codes, please visit https://icann.org/epp


The data in this whois database is provided to you for information
purposes only, that is, to assist you in obtaining information about or
related to a domain name registration record. We make this information
available "as is," and do not guarantee its accuracy. By submitting a
whois query, you agree that you will use this data only for lawful
purposes and that, under no circumstances will you use this data to: (1)
enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or (2) allow,
enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic
mail, or by telephone. The compilation, repackaging, dissemination or
other use of this data is expressly prohibited without prior written
consent from us.

We reserve the right to modify these terms at any time. By submitting
this query, you agree to abide by these terms.
Version 6.3 4/3/2002