OuterStats is here to display any thing is needed for www.websiteribbon.com. We seek and locate Websiteribbon.com information for inquirer. We will show you Websiteribbon value, date of creation, location, hosted server, local language and estimated data - The estimated data is a special algorithm built by us to demonstrate www.websiteribbon.com worth.

Diagonal Advertising Banner Design | Free Corner Web Banner Ads

Free advertising banner web design tool to make on websites a corner diagonal banner ad containing a message and optional link.

Websiteribbon.com was created on the 2007-06-09, domain is hosted in ip:, and owner of this ips: LINODE-US . Websiteribbon.com using Apache/2.2.15 (CentOS) server and powered by unknown.

Created: 09/06/2007

Expires: unavailable

Hosted in: United States

Host IP:

ICANN Registrar: eNom, Inc.

Domain Archive: websiteribbon.com in the past

Alexa Rank: #0

Google Page Rank: 0

Server DNS A:

Server DNS NS: dns1.registrar-servers.com dns5.registrar-servers.com dns3.registrar-servers.com dns4.registrar-servers.com dns2.registrar-servers.com

Server Name: unavailable

Server Type: Apache/2.2.15 (CentOS)

Server Side Language: unavailable

websiteribbon.com - Daily Traffic Rank Trend In The Past 4 Months

Keyword Count Density
Banner 19 8.8
Diagonal 8 3.7
Design 8 3.7
Advertising 7 3.24
Corner 7 3.24
Message 4 1.85
Verdana 3 1.39
Tahoma 3 1.39
Optional 3 1.39
Containing 2 0.93
Webmaster 2 0.93
Font 2 0.93
Scripts 2 0.93
Color 2 0.93
Bidding 1 0.46
Submitting 1 0.46
Aliceblueantiquewhiteaquaaquamarineazurebeigebisqueblackblanchedalmondbluebluevioletbrownburlywoodcadetbluechartreusechocolatecoralcornflowerbluecornsilkcrimsoncyandarkbluedarkcyandarkgoldenroddarkgraydarkgreendarkkhakidarkmagentadarkolivegreendarkorangedarkorchiddarkreddarksalmondarkseagreendarkslatebluedarkslategraydarkturquoisedarkvioletdeeppinkdeepskybluedimgraydodgerbluefeldsparfirebrickfloralwhiteforestgreenfuchsiagainsboroghostwhitegoldgoldenrodgraygreengreenyellowhoneydewhotpinkindianredindigoivorykhakilavenderlavenderblushlawngreenlemonchiffonlightbluelightcorallightcyanlightgoldenrodyellowlightgreenlightgreylightpinklightsalmonlightseagreenlightskybluelightslatebluelightslategraylightsteelbluelightyellowlimelimegreenlinenmagentamaroonmediumaquamarinemediumbluemediumorchidmediumpurplemediumseagreenmediumslatebluemediumspringgreenmediumturquoisemediumvioletredmidnightbluemintcreammistyrosemoccasinnavajowhitenavyoldlaceoliveolivedraborangeorangeredorchidpalegoldenrodpalegreenpaleturquoisepalevioletredpapayawhippeachpuffperupinkplumpowderbluepurpleredrosybrownroyalbluesaddlebrownsalmonsandybrownseagreenseashellsiennasilverskyblueslateblueslategraysnowspringgreensteelbluetantealthistletomatoturquoisevioletvioletredwheatwhitewhitesmokeyellowyellowgreen 1 0.46
Including 1 0.46
Reviewed 1 0.46
Choice 1 0.46
Theme 1 0.46
Header Key Header Value
Date Tue, 05 Dec 2017 05:04:10 GMT
Server Apache/2.2.15 (CentOS)
Location http://www.websiteribbon.com/
Content-Length 320
Content-Type text/html; charset=iso-8859-1


Server Country Code: US

Server Country Name: United States

Server City Name: Fremont

Server Region Name: CA

Server Zip Code: 94536

Server Latitude: 37.548301696777

Server Longitude: -121.98860168457

Server location

wsbsiteribbon.com, wensiteribbon.com, wewsiteribbon.com, webliteribbon.com, webviteribbon.com, websateribbon.com, websfteribbon.com, websiyeribbon.com, websiteribbon.com, websiteriibon.com, websiteribgon.com, websiteriblon.com, websiteribbjn.com, websiteribbvn.com, websiteribbob.com, websiteribbod.com, websiteribbom.com, websiteribbondcom, websiteribbonlcom, websiteribbonvcom, websiteribbon.cgm, websiteribbon.coa, websiteribbon.coh, websiteribbon.col, webisteribbon.com, websiteribbonc.om, awebsiteribbon.com, swebsiteribbon.com, wgebsiteribbon.com, wefbsiteribbon.com, wexbsiteribbon.com, websniteribbon.com, websiuteribbon.com, websitgeribbon.com, websitekribbon.com, websiteqribbon.com, websitewribbon.com, websiteruibbon.com, websiteriubbon.com, websiteribibon.com, websiteribkbon.com, websiteribbcon.com, websiteribbron.com, websiteribbyon.com, websiteribbomn.com, websiteribbon.ncom, websiteribbon.cobm, websiteribbon.coym, websiteribbon.come, websiteribbon.comx

Registry Domain ID: 1018778613_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.enom.com
Registrar URL: http://www.enom.com
Updated Date: 2017-07-28T23:18:54Z
Creation Date: 2007-06-09T17:06:58Z
Registry Expiry Date: 2018-11-15T04:59:59Z
Registrar: eNom, Inc.
Registrar IANA ID: 48
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-12-05T05:03:48Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.

TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.

The Registry database contains ONLY .COM, .NET, .EDU domains and

Recent Analyzed Websites

Recent Visited Websites